PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG415300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 232aa    MW: 26101.5 Da    PI: 9.213
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG415300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.58.7e-29959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien +nrqvt+skRr+gi+KKA EL vLCda+va+i+fsstgk +e++s
  Pavir.9NG415300.1.p  9 KRIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCS 59
                         79***********************************************96 PP

2K-box87.91.9e-2971168198
                K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                          yq++ g+sl+ +++e++q+ l+ Lk+ ++nL++e+R+++GedL+sL++ eL+ Leq+++++lk++R +K++++++q+e+ +kk k   e+
  Pavir.9NG415300.1.p  71 YQQAIGTSLWVEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDSLEFDELRGLEQNVDTALKEVRHRKYHVITTQTETYKKKVKHSYEA 160
                          67888999********************************************************************************** PP

                K-box  91 nkaLrkkl 98 
                           k+L+++l
  Pavir.9NG415300.1.p 161 YKNLQHEL 168
                          ****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.59161IPR002100Transcription factor, MADS-box
CDDcd002651.93E-42280No hitNo description
SuperFamilySSF554552.09E-36295IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-28323IPR002100Transcription factor, MADS-box
PfamPF003193.1E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-283859IPR002100Transcription factor, MADS-box
PfamPF014864.6E-2282168IPR002487Transcription factor, K-box
PROSITE profilePS5129715.34584174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGRGKIEIKR IENATNRQVT YSKRRTGIMK KARELTVLCD AQVAIIMFSS TGKYHEFCSP  60
GTDIKTIFDR YQQAIGTSLW VEQYENMQRT LSHLKDINRN LRTEIRQRMG EDLDSLEFDE  120
LRGLEQNVDT ALKEVRHRKY HVITTQTETY KKKVKHSYEA YKNLQHELGM REDPAFGFVD  180
NTAAGGGGWD GAVALGGGGG GPGPDMYAFR VVPSQPNLHG MAYGSHDLRL G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D1e-16271168Myocyte-specific enhancer factor 2A
3mu6_C1e-16271168Myocyte-specific enhancer factor 2A
3mu6_B1e-16271168Myocyte-specific enhancer factor 2A
3mu6_A1e-16271168Myocyte-specific enhancer factor 2A
1egw_D2e-16273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-16273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-16273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-16273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J2e-16273170Myocyte-specific enhancer factor 2A
3p57_I2e-16273170Myocyte-specific enhancer factor 2A
3p57_D2e-16273170Myocyte-specific enhancer factor 2A
3p57_C2e-16273170Myocyte-specific enhancer factor 2A
3p57_B2e-16273170Myocyte-specific enhancer factor 2A
3p57_A2e-16273170Myocyte-specific enhancer factor 2A
3kov_J2e-16273170Myocyte-specific enhancer factor 2A
3kov_I2e-16273170Myocyte-specific enhancer factor 2A
3kov_B2e-16273170Myocyte-specific enhancer factor 2A
3kov_A2e-16273170Myocyte-specific enhancer factor 2A
1tqe_S2e-16173171Myocyte-specific enhancer factor 2B
1tqe_R2e-16173171Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0399880.0BT039988.1 Zea mays full-length cDNA clone ZM_BFc0056L03 mRNA, complete cds.
GenBankEU9662370.0EU966237.1 Zea mays clone 292756 MADS-box transcription factor 16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966424.11e-160PREDICTED: MADS-box transcription factor 16
SwissprotQ944S91e-142MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBLK3XZ631e-160K3XZ63_SETIT; Uncharacterized protein
STRINGSi007221m1e-160(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57283552
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.12e-66MIKC_MADS family protein